Content And Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Target Species |
Human |
Host Species |
Rabbit |
Conjugate |
Unconjugated |
Applications |
Western Blot,Immunocytochemistry |
Form |
Purified |
Isotype |
IgG |
Research Discipline |
Zinc Finger |
Antigen |
Ring finger protein 138 |
Regulatory Status |
RUO |
Purification Method |
Immunogen affinity purified |
Dilution |
Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
Gene Alias |
E3 ubiquitin-protein ligase RNF138, EC 6.3.2.-, hNARF, HSD-4, MGC8758, NARF, Nemo-like kinase-associated RING finger protein, ring finger protein 138NLK-associated RING finger protein, STRIN |
Gene ID (Entrez) |
51444 |
Formulation |
PBS (pH 7.2) and 40% Glycerol |
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YCPVCREVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYR |
Classification |
Polyclonal |
Primary or Secondary |
Primary |