missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Osteocalcin Antibody (190125) [Janelia Fluor™ 525], Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals FAB1419JF525
This item is not returnable.
View return policy
Description
Osteocalcin Monoclonal antibody specifically detects Osteocalcin in Human,Rat samples. It is validated for Immunohistochemistry,Flow Cytometry (Intracellular Staining),Immunocytochemistry,CyTOF
Specifications
| Osteocalcin | |
| Monoclonal | |
| Janelia Fluor 525 | |
| BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin | |
| Human Osteocalcin synthetic peptide, YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV, Accession # P02818 | |
| RUO | |
| Primary | |
| Human, Rat | |
| Liquid |
| Immunohistochemistry, Flow Cytometry (Intracellular Staining), Immunocytochemistry, CyTOF | |
| 190125 | |
| 50mM Sodium Borate | |
| Mouse | |
| 0.1 mL | |
| Extracellular Matrix, Stem Cell Markers | |
| 632 | |
| Store at 4°C in the dark. | |
| IgG1 |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction