ring finger protein 182, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant RNF182.

Brand:  Abnova H00221687-A01.50uL

Product Code. 16132487

Description

Sequence: MASQPPEDTAESQASDELECKICYNRYNLKQRKPKVLECCHRVCAKCLYKIIDFGDSPQGVIVCPFCRFETCLPDDEVSSLPDDNNILVNLTCGGKGKK

Specifications

• Antigen: ring finger protein 182
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant RNF182.
• Gene: RNF182
• Gene Alias: FLJ40772/MGC33993
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Ubiquitin/Proteasome
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_152737
• Gene Symbols: RNF182
• Immunogen: RNF182 (NP_689950, 1 a.a. ∼ 99 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 221687
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.