missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ C18orf37 Recombinant Protein
£290.00 - £441.00
Specifications
| Accession Number | AAH48989 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| Gene ID (Entrez) | 125476 |
| Molecular Weight (g/mol) | 40.81 |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16187673
|
Abnova™
H00125476-P01.10ug |
10 μg |
£290.00
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
16197673
|
Abnova™
H00125476-P01.25ug |
25 μg |
£441.00
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
| AAH48989 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 40.81 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| INO80C | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 125476 | |
| C18orf37 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPWQLNDPNYFSIDAPPSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTGYLALRKATSIVP | |
| C18orf37/FLJ38183/IES6/hIes6 | |
| INO80C | |
| Wheat Germ (in vitro) | |
| GST |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title