Novus Biologicals™ calmodulin-lysine N-methyltransferase Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP2-57496PEP

Product Code. 18252415

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human calmodulin-lysine N-methyltransferase. Source: E.coli Amino Acid Sequence: SEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEG The calmodulin-lysine N-methyltransferase Recombinant Protein Antigen is derived from E. coli. The calmodulin-lysine N-methyltransferase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 79823
• Common Name: calmodulin-lysine N-methyltransferase Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Alias: C2orf34, calmodulin methyltransferase, calmodulin-lysine N-methyltransferase, Cam, CaM KMT, chromosome 2 open reading frame 34, CLNMTFLJ23451, EC 2.1.1.60, KMT
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: CAMKMT
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53063. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.