missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Coronin-1a Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13861-25ul
228.00 GBP valid until 2025-03-28
Use promo code "25306" to get your promotional price.
This item is not returnable.
View return policy
Description
Coronin-1a Polyclonal antibody specifically detects Coronin-1a in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
Coronin-1a | |
Polyclonal | |
Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
clipin-A, CLIPINA, CORO1, coronin, actin binding protein, 1A, coronin, actin-binding protein, 1A, coronin-1, coronin-1A, Coronin-like protein A, Coronin-like protein p57, FLJ41407, HCORO1, MGC117380, p57, TACOCLABP, Tryptophan aspartate-containing coat protein | |
This antibody was developed against a recombinant protein corresponding to the amino acids: RELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQA | |
25 μL | |
Cell Cycle and Replication, Immunology, Innate Immunity, Neuroscience | |
11151 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Coronin-1a Antibody, Novus Biologicals™ > 25 μL; Unconjugated
Spot an opportunity for improvement?Share a Content Correction