missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Cysteine/histidine-rich 1 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP2-56486PEP
Additional Details : Weight : 0.00970kg
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human cysteine/histidine-rich 1. Source: E.coli Amino Acid Sequence: ECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFIT The cysteine/histidine-rich 1 Recombinant Protein Antigen is derived from E. coli. The cysteine/histidine-rich 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
50626 | |
Cysteine/histidine-rich 1 Recombinant Protein Antigen | |
PBS and 1M Urea, pH 7.4. | |
CHRP, cysteine and histidine rich 1, cysteine and histidine-rich protein 1, cysteine/histidine-rich 1, KIAA0496cysteine and histidine rich protein, MGC13010 | |
Unlabeled | |
100μL | |
E.coli |
>80% by SDS-PAGE and Coomassie blue staining | |
Store at −20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
CYHR1 | |
Recombinant Protein Antigen | |
RUO | |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49974. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
For Research Use Only.