missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNA Polymerase epsilon subunit 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£285.00 - £513.00
Specifications
Antigen | DNA Polymerase epsilon subunit 3 |
---|---|
Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
18406161
|
Novus Biologicals
NBP2-13785 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
18423122
|
Novus Biologicals
NBP2-13785-25ul |
25 μL |
£285.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNA Polymerase epsilon subunit 3 Polyclonal antibody specifically detects DNA Polymerase epsilon subunit 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
DNA Polymerase epsilon subunit 3 | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Chromatin Research, DNA Polymerases, DNA Repair | |
PBS (pH 7.2) and 40% Glycerol | |
54107 | |
IgG | |
Immunogen affinity purified |
Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
Arsenic-transactivated protein, asTP, CHARAC17arsenic transactivated protein, CHRAC-17, CHRAC17Ybl1, Chromatin accessibility complex 17 kDa protein, DNA polymerase epsilon p17 subunit, DNA polymerase epsilon subunit 3, DNA polymerase epsilon subunit p17, DNA polymerase II subunit 3, EC 2.7.7.7, histone fold protein CHRAC17, HuCHRAC17, p17, polymerase (DNA directed), epsilon 3 (p17 subunit), YBL1 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLN | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
DNA Polymerase epsilon subunit 3 Antibody, Novus Biologicals™