missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ dsbG (Escherichia coli) Recombinant Protein

Used for SDS-PAGE

Brand: Abnova™ P4977.100ug

Product Code. 16101710

£318.00 / 100µg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Sequence: MEELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGNK

Specifications

Accession Number	NP_415137
For Use With (Application)	SDS-PAGE
Gene ID (Entrez)	945224
Name	dsbG (Escherichia coli) Recombinant protein
Purification Method	Conventional Chromatography
Quantity	100 μg
Storage Requirements	Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	ECK0598/JW0597/ybdP
Gene Symbol	dsbG
Protein Tag	None
Form	Liquid

Concentration	1 mg/mL
Formulation	Liquid
Molecular Weight (g/mol)	55.7kDa
Preparation Method	Escherichia coli expression system
Quality Control Testing	15% SDS-PAGE Stained with Coomassie Blue
Immunogen	MEELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLNIIMGNK
Regulatory Status	RUO
Common Name	dsbG
Species	E. coli
Expression System	Escherichia coli expression system
Purity or Quality Grade	>95% by SDS-PAGE

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Abnova™ dsbG (Escherichia coli) Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Special Offers