missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GMPS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP1-52972
Additional Details : Weight : 0.00970kg
Description
GMPS Polyclonal specifically detects GMPS in Human samples. It is validated for Western Blot.Specifications
GMPS | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein | |
Rabbit | |
77 kDa | |
100 μL | |
metabolism | |
8833 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P49915 | |
GMPS | |
Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA. | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Guinea pig: 92%; Zebrafish: 92%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |