GMPS, Mouse anti-Human, Clone: 6B5, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00008833-M02.100ug

Product Code. 16139395

Description

Sequence: QMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSG

Specifications

• Antigen: GMPS
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: guanine monphosphate synthetase
• Gene Alias: -
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 6B5
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_003875
• Gene Symbols: GMPS
• Immunogen: GMPS (NP_003866, 108 a.a. ∼ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 8833
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ