Novus Biologicals™ GMPS Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP2-56670PEP

Product Code. 18243342

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GMPS. Source: E.coli Amino Acid Sequence: AGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLT The GMPS Recombinant Protein Antigen is derived from E. coli. The GMPS Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 8833
• Common Name: GMPS Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Alias: EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein
• Label Type: Unlabeled
• Quantity: 100μL
• Research Category: metabolism
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51515. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: GMPS
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Source: E.coli

For Research Use Only.