HDJ2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marke:  Novus Biologicals NBP1-91453

Artikelnummer. 18255769

Beschreibung

HDJ2 Polyclonal specifically detects HDJ2 in Mouse samples. It is validated for Western Blot.

Spezifikation

• Antigen: HDJ2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dj-2, DjA1, DnaJ (Hsp40) homolog, subfamily A, member 1, dnaJ homolog subfamily A member 1, DnaJ protein homolog 2, DNAJ2, hDJ-2, HDJ2, Heat shock 40 kDa protein 4, Heat shock protein J2, heat shock protein, DNAJ-like 2, HSDJ, HSJ2, HSJ-2, HSPF4hdj-2, Human DnaJ protein 2, NEDD7, neural precursor cell expressed, developmentally down-regulated 7
• Host Species: Rabbit
• Molecular Weight of Antigen: 44 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Xenopus: 78%; Chicken: 78%; Zebrafish: 79% yeast 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_032324
• Gene Symbols: DNAJA1
• Immunogen: Synthetic peptide directed towards the N terminal of human Dnaja1. Peptide sequence YDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLAD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3301
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.