Invitrogen™ Human Carbonic Anhydrase VI (aa 119-215) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP94191

Product Code. 30194647

Description

The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown.

Specifications

• Accession Number: P23280
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 765
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: CA6
• Species: Human
• Sequence: SEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTY
• Form: Liquid

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: Carbonic Anhydrase VI
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: CA6; CA-6; Car6; Carbonate dehydratase VI; carbonic anhydrase 6; Carbonic anhydrase VI; carbonic anhydrase VI nirs variant 2; Carbonic anhydrase6; CA-VI; DOC1; GUSTIN; salivary carbonic anhydrase; Secreted carbonic anhydrase
• Conjugate: Unconjugated
• Recombinant: Recombinant
• Expression System: E. coli