Invitrogen™ Human Cathepsin L (aa 13-42) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP109208

Product Code. 30206052

Description

The protein encoded by this gene is a lysosomal cysteine proteinase that plays a major role in intracellular protein catabolism. Its substrates include collagen and elastin, as well as alpha-1 protease inhibitor, a major controlling element of neutrophil elastase activity. The encoded protein has been implicated in several pathologic processes, including myofibril necrosis in myopathies and in myocardial ischemia, and in the renal tubular response to proteinuria. This protein, which is a member of the peptidase C1 family, is a dimer composed of disulfide-linked heavy and light chains, both produced from a single protein precursor. At least two transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: P07711
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 1514
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: CTSL
• Species: Human
• Sequence: GIASATLTFDHSLEAQWTKWKAMHNRLYGM
• Form: Liquid

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: Cathepsin L
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: 1190035F06Rik; Cat L; cathepsin L; Cathepsin L1; Cathepsin L1 heavy chain; Cathepsin L1 light chain; CATHL; CatL; CP-2; Ctsl; CTSL1; cyclic protein 2; fs; furless; major excreted protein; MEP; nackt; nkt; p39 cysteine proteinase; Procathepsin L
• Conjugate: Unconjugated
• Recombinant: Recombinant
• Expression System: E. coli