missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CILP2 (aa 488-602) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP99119

Product Code. 30182851

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Specifications

Accession Number	Q8IUL8
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	148113
Quantity	100 μL
Regulatory Status	RUO
Gene Symbol	CILP2
Species	Human
Sequence	LRFARILLGQEPIGFTAYQGDFTIEVPPSTQRLVVTFVDPSGEFMDAVRVLPFDPRGAGVYHEVKAMRKKAPVILHTSQSNTIPLGELEDEAPLGELVLPSGAFRRADGKPYSGP
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1M urea, PBS with no preservative; pH 7.4
Name	CILP2
Storage Requirements	-20° C, Avoid Freeze/Thaw Cycles
Gene Alias	1110031K21Rik; AA407300; cartilage intermediate layer protein 2; Cartilage intermediate layer protein 2 C1; Cartilage intermediate layer protein 2 C2; cartilage intermediate layer protein-like protein 2; Cilp2; CILP-2; CLIP-2
Conjugate	Unconjugated
Recombinant	Recombinant
Expression System	E. coli

Product Suggestions

Description