Invitrogen™ Human CLASP1 (aa 1112-1170) Control Fragment Recombinant Protein

Recombinant Protein

Marca: Invitrogen™ RP103589

Codice prodotto. 30194184

Please sign in to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

CLASPs, such as CLASP1, are nonmotor microtubule-associated proteins that interact with CLIPs.

Specifica

Accession Number	Q7Z460
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	23332
Quantity	100 μL
Regulatory Status	RUO
Gene Symbol	CLASP1
Species	Human
Sequence	TSPTNCSHGGLSPSRLWGWSADGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDT
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1M urea, PBS with no preservative; pH 7.4
Name	CLASP1
Storage Requirements	-20° C, Avoid Freeze/Thaw Cycles
Gene Alias	1700030C23Rik; 5730583A19Rik; B130045P17Rik; CLASP1; CLASP1alpha; CLIP associating protein 1; CLIP-associating protein 1; cytoplasmic linker associated protein 1; cytoplasmic linker-associated protein 1; hOrbit1; Kiaa0622; MAST1; multiple asters 1; multiple asters homolog 1; Protein Orbit homolog 1
Conjugate	Unconjugated
Recombinant	Recombinant
Expression System	E. coli

Suggerimenti di prodotto

Descrizione