Invitrogen™ Human CLIP1 (aa 1288-1437) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP92538

Product Code. 30205190

Description

CLIP170 was initially identified as a new type of intermediate filament associated protein that is highly expressed in Reed-Sternberg cells, the tumoral cells diagnostic for Hodgkin's disease. Later experiments showed that it is located at microtubule plus ends and is required for the binding of endocytic carrier vesicles. CLIP170 has also been suggested to act with LIS1, a protein implicated in brain development, to regulate dynein/dynactin binding microtubules. Other studies suggest that CLIP170 can influence the formation of lamellipodia and cell invasion by invasive breast cancer cells by regulating the release of kinesin and IQGAP1 from a complex of those proteins, CLIP170 and Rac1. At least two isoforms of CLIP170 are known to exist.

Specifications

• Accession Number: P30622
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 6249
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: CLIP1
• Recombinant: Recombinant
• Expression System: E. coli

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: CLIP1
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: 1110007I12Rik; 4631429H07Rik; AV017631; C81039; CAP-Gly domain containing linker protein 1; CAP-Gly domain-containing linker protein 1; CLIP; Clip 170; Clip1; CLIP170; CLIP-170; Clip50; Cyln1; cytoplasmic linker protein 1; Cytoplasmic linker protein 170; Cytoplasmic linker protein 170 alpha-2; cytoplasmic linker protein 50; cytoplasmic linker protein CLIP-170; Kiaa4046; MGC131604; mKIAA4046; Reed-Steinberg cell-espressed intermediate filament-associated protein; Reed-Sternberg intermediate filament-associated protein; Restin; restin (Reed-Steinberg cell-espressed intermediate filament-associated protein); restin (Reed-Steinberg cell-expressed intermediate filament-associated protein); Rsn
• Conjugate: Unconjugated
• Sequence: KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET