Invitrogen™ Human CLIP2 (aa 317-465) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP95914

Product Code. 30211731

Description

The protein encoded by this gene belongs to the family of cytoplasmic linker proteins, which have been proposed to mediate the interaction between specific membranous organelles and microtubules. This protein was found to associate with both microtubules and an organelle called the dendritic lamellar body. This gene is hemizygously deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.

Specifications

• Accession Number: Q9UDT6
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 7461
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: CLIP2
• Recombinant: Recombinant
• Expression System: E. coli

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: CLIP2
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: B230327O20; CAP-Gly domain containing linker protein 2; CAP-Gly domain-containing linker protein 2; CLIP; Clip1; CLIP-115; Clip2; Cyln2; cytoplasmic linker 2; cytoplasmic linker protein 1, 115 kDa; cytoplasmic linker protein 115; Cytoplasmic linker protein 2; Kiaa0291; mKIAA0291; testicular tissue protein Li 40; WBSCR3; WBSCR4; williams-Beuren syndrome chromosomal region 3 protein; Williams-Beuren syndrome chromosomal region 4 protein; Williams-Beuren syndrome chromosome region 3; Williams-Beuren syndrome chromosome region 4; WSCR3; WSCR4
• Conjugate: Unconjugated
• Sequence: SSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEALKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLLVESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLELTTVA