missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CLIP3 (aa 345-432) Control Fragment Recombinant Protein

Recombinant Protein

Brand: Invitrogen™ RP98966

Product Code. 30180568

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Functions as a cytoplasmic linker protein. Involved in TGN-endosome dynamics.

Specifications

Accession Number	Q96DZ5
For Use With (Application)	Blocking Assay, Control
Gene ID (Entrez)	25999
Quantity	100 μL
Regulatory Status	RUO
Gene Symbol	CLIP3
Species	Human
Sequence	FICPPKQGLFASVSKISKAVDAPPSSVTSTPRTPRMDFSRVTGKGRREHKGKKKTPSSPSLGSLQQRDGAKAEVGDQVLVAGQKQGIV
Form	Liquid

Concentration	≥5.0 mg/mL
Formulation	1M urea, PBS with no preservative; pH 7.4
Name	CLIP3
Storage Requirements	-20° C, Avoid Freeze/Thaw Cycles
Gene Alias	1500005P14Rik; AI844915; CAP-GLY domain containing linker protein 3; CAP-Gly domain-containing linker protein 3; clip-170 related protein 59 kDa; CLIP-170-related 59 kDa protein; Clip3; CLIPR59; Clipr-59; Cytoplasmic linker protein 170-related 59 kDa protein; restin-like 1; RGD1306245; RSNL1
Conjugate	Unconjugated
Recombinant	Recombinant
Expression System	E. coli

Product Suggestions

Description