missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CLOCK Partial ORF (NP_004889, 497 a.a. - 596 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
£280.00 - £425.00
Specifications
Accession Number | NP_004889 |
---|---|
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 9575 |
Molecular Weight (g/mol) | 36.74kDa |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16160956
|
Abnova™
H00009575-Q01.10UG |
10 ug |
£280.00
10µg |
Estimated Shipment: 21-08-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16170956
|
Abnova™
H00009575-Q01.25UG |
25 ug |
£425.00
25µg |
Estimated Shipment: 21-08-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene encodes a protein that belongs to the basic helix-loop-helix (bHLH) family of transcription factors. Polymorphisms within the encoded protein have been associated with circadian rhythm sleep disorders. A similar protein in mice is a circadian regulator that acts as a transcription factor and forms a heterodimer with aryl hydrocarbon receptor nuclear translocator-like to activate transcription of mouse period 1. [provided by RefSeq]
Sequence: PVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINSpecifications
NP_004889 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
KAT13D/KIAA0334/bHLHe8 | |
CLOCK | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
9575 | |
CLOCK (Human) Recombinant Protein (Q01) | |
PVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPIN | |
RUO | |
CLOCK | |
Wheat Germ (in vitro) | |
GST | |
Liquid |