missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ESRP1 (aa 23-102) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP105415

154.00 GBP valid until 2025-03-29
Use promo code "24111" to get your promotional price.


Product Code. 30194453

  • £231.00 / 100µL

Please to purchase this item. Need a web account? Register with us today!

Explore more special offers

Alert:

To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price

This item is not returnable. View return policy

Description

Description

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84744 (PA5-84744. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RBM35A, also known as ESRP1, is a mRNA splicing factor that with its related protein RBM35B (ESRP2) are coordinators of an epithelial cell-type-specific splicing program. RBM35A contains three putative RNA recognition motifs and acts by directly binding specific sequences in mRNAs. RBM35A is involved in posttranscriptional regulation of a number of genes such as FGFR2, CD44, CTNND1, and ENAH by exerting a differential effect on protein translation via 5' UTRs of mRNAs. Other recent studies have shown that RMB35A may also act as a novel tumor suppressor.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

Q6NXG1
Blocking Assay, Control
54845
100 μL
2210008M09Rik; A630065D16; BC031468; epithelial splicing regulatory protein 1; Esrp1; Rbm35a; RGD1560481; RMB35A; RNA binding motif protein 35 A; RNA-binding motif protein 35 A; RNA-binding protein 35 A
ESRP1
Human
His-ABP-tag
-20°C, Avoid Freeze/Thaw Cycles
Liquid
≥5.0 mg/mL
1 M urea, PBS with no preservative; pH 7.4
Human ESRP1 (aa 23-102) Control Fragment
RUO
ESRP1
Unconjugated
Recombinant
LGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGT
E. coli
>80% by SDS-PAGE and Coomassie blue staining
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human ESRP1 (aa 23-102) Control Fragment Recombinant Protein > 100 μL; Unlabeled

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.