missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194172

Invitrogen™ Human HKR1 (aa 225-290) Control Fragment Recombinant Protein

Product Code. 30194172
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194172

Brand: Invitrogen™ RP106075

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65392 (PA5-65392. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. The majority of zinc-finger proteins contain a Kruppeltype DNA binding domain and a KRAB domain, which is thought to interact with KAP1, thereby recruiting histone modifying proteins. HKR1, also known as Krueppel-related zinc finger protein 1 or zinc finger protein 875, is a 659 amino acid nuclear protein that is thought to play a role in transcriptional regulation. Existing as two alternatively spliced isoforms, HKR1 is a member of the Krueppel C2H2-type zinc-finger protein family and contains thirteen C2H2-type zinc fingers and one KRAB domain. The gene encoding HKR1 maps to human chromosome 19q13.12.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P10072
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 284459
Name Human HKR1 (aa 225-290) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias GLI-Kruppel family member HKR1; HKR1; HKR1, GLI-Kruppel zinc finger family member; Krueppel-related zinc finger protein 1; oncogene HKR1; Protein HKR1; Zinc finger protein 875; ZNF875
Common Name HKR1
Gene Symbol HKR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ADLEETDKVLHGLEVSGFGEIKYEEFGPGFIKESNLLSLQKTQTGETPYMYTEWGDSFGSMSVLIK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.