Invitrogen™ Human MEP1A (aa 521-656) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP90933

Product Code. 30211044

Description

MEP1A (Meprin A Subunit Alpha) is a Protein Coding gene. Among its related pathways are Collagen chain trimerization. Gene Ontology (GO) annotations related to this gene include metalloendopeptidase activity and metallopeptidase activity.

Specifications

• Accession Number: Q16819
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 4224
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: MEP1A
• Species: Human
• Sequence: MSSSMVFTTSKSHTSPAINDTVIWDRPSRVGTYHTDCNCFRSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLSQTEVPTKGKRLSPQGLILQGQEQQVSEEGSGKAMLEEALPVSLSQGQPSRQKRSVE
• Form: Liquid

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: MEP1A
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: AI098089; AW107200; bA268F1.1 (meprin A alpha (PABA peptide hydrolase)); E-24.18; Endopeptidase-2; endopeptidase-24.18 subunit alpha; Mep1; Mep-1; MEP1A; Mep-1a; meprin 1 alpha; meprin A alpha; meprin A alpha-subunit; meprin A subunit alpha; meprin A, alpha (PABA peptide hydrolase); meprin alpha; N-benzoyl-L-tyrosyl-P-amino-benzoic acid hydrolase subunit alpha; PABA peptide hydrolase; PPH alpha; PPHA
• Conjugate: Unconjugated
• Recombinant: Recombinant
• Expression System: E. coli