Invitrogen™ Human MGA (aa 2108-2248) Control Fragment Recombinant Protein

Artikelnummer. 30212247

missing translation for 'mfr': Invitrogen™ RP102486

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59934 (PA5-59934. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Functions as a dual-specificity transcription factor, regulating the expression of both MAX-network and T-box family target genes. Functions as a repressor or an activator. Binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence and seems to regulate MYC-MAX target genes. Suppresses transcriptional activation by MYC and inhibits MYC-dependent cell transformation. Function activated by heterodimerization with MAX. This heterodimerization serves the dual function of both generating an E-box-binding heterodimer and simultaneously blocking interaction of a corepressor. [UniProt]

Spezifikation

• Accession Number: Q8IWI9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23269
• Name: Human MGA (aa 2108-2248) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AV312082; C130042M01Rik; C80739; D030062C11Rik; FLJ12634; KIAA0518; Kiaa4252; LOW QUALITY PROTEIN: MAX gene-associated protein; Mad5; maltase-glucoamylase (alpha-glucosidase); Max dimerization protein 5; MAX dimerization protein MGA; MAX gene associated; MAX gene-associated protein; MAX protein-associated protein-like protein; MAX-associated protein; MAX-interacting protein; MGA; MGA, MAX dimerization protein; MGA-like protein; MXD5; RGD1561597
• Common Name: MGA
• Gene Symbol: MGA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLGDVKVEQQKGFDNPEENSSEFPVTFKEESKFELSGSKVMEQQSNLQPEAKEKECGDSLEKDRERWRKHLKGPLTRKCVGASQECKKEADEQLIKETKTCQENSDVFQQEQGISDLLGKSGITEDARVLKTECDSWSRIS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining