Invitrogen™ Human MORF (aa 1186-1318) Control Fragment Recombinant Protein

Product Code. 30210358

Brand: Invitrogen™ RP89372

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52251 (PA5-52251. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MOZ (monocytic leukemia zinc finger protein) is a chromatin-associated histone acetyltransferase (HAT) that regulates chromatin remodeling and transcription. The MOZ gene was initially isolated as a consequence of two variant translocations that were identified in a distinct subtype of acute myeloid leukemias and resulted in the formation of MOZ fusion proteins. These fusions involve the HAT domain of MOZ with the activation domain of either transcriptional coactivator protein TIF2/GRIP1 or CBP, and lead to enhanced transcriptional activation by a mechanism involving aberrant histone acetylation. Additional MOZ related proteins, including MORF (MOZ related factor) and Tip60 (TAT interacting proteins 60), share significant similarities with MOZ including the putuative HAT domain. MORF also contains a strong transcriptional repression domain at its N terminus and a highly potent activation domain at the C terminus, suggesting that MORF has both HAT activity and contributes to the regulation of transcriptional activation. Tip60 was originally identified as a coactivator for the HIV TAT protein and also functions as a nuclear hormone receptor coactivator that enhances ligand dependent steroid receptor-mediated transactivation involving the androgen, estrogen and progesterone receptors.

Specifications

• Accession Number: Q8WYB5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23522
• Name: Human MORF (aa 1186-1318) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI507552; B130044K16Rik; GTPTS; histone acetyltransferase KAT6B; histone acetyltransferase MORF; histone acetyltransferase MOZ2; histone acetyltransferase MYST4; histone acetyltransferase querkopf; K(lysine) acetyltransferase 6 B; Kat6b; KIAA0383; lysine acetyltransferase 6 B; mKIAA0383; monocytic leukemia; monocytic leukemia zinc finger protein-related factor; MORF; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 4; MOZ2; MOZ-related factor; MYST histone acetyltransferase (monocytic leukemia) 4; MYST histone acetyltransferase monocytic leukemia 4; Myst4; MYST-4; protein querkopf; qkf; querkopf; SAS2; TIP60 protein 4; ZC2HC6B
• Common Name: MORF
• Gene Symbol: KAT6B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KPVLRKAFQHQPGKKRQTEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRGLSKWRQNKERKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPSPIRIEEEVKETGEAL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining