Learn More
Invitrogen™ Human MUC1 Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP102279
154.00 GBP valid until 2025-03-29
Use promo code "24111" to get your promotional price.
Alert:
To receive the discount customers must purchase three of the same product at list price in a single order to receive 33.33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price
Description
Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
MUC1 (Mucin 1, Episialin, MAM-6, CA 15-3, PEM and EMA) is a large cell surface mucin glycoprotein expressed by most glandular and ductal epithelial cells and some hematopoietic cell lineages. MUC1 is a transmembrane glycoprotein with a large mucin-like extracellular domain that matures through several intermediate forms generated by proteolysis, and sequential addition and processing of numerous O-linked glycans that are heavily sialylated. MUC1 is highly polymorphic and each allele encodes a product that contains a different number of repeats (between 30 and 90) leading to large differences in molecular weight of the protein. MUC1 is expressed on most secretory epithelium, including mammary gland and some hematopoietic cells, and is expressed abundantly in >90% breast carcinomas and metastases. Transgenic MUC1 has been shown to associate with all four cebB receptors and localize with erbB1 (EGFR) in lactating glands. The MUC1 gene contains seven exons and produces several different alternatively spliced variants. Overexpression, aberrant intracellular localization, and changes in glycosylation of the MUC1 protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of the MUC1 gene have been reported, but the full-length nature of only some has been determined. Transgenic MUC-1 has been shown to associate with all four cebB receptors and localize with erbB1 (EGFR) in lactating glands.
Specifications
P15941 | |
Blocking Assay, Control | |
4582 | |
100 μL | |
ADMCKD; ADMCKD1; Breast carcinoma-associated antigen DF3; CA 15-3; Cancer antigen 15-3; carcinoma-associated mucin; CD227; DF3 antigen; EMA; Episialin; H23 antigen; H23AG; J19; KL-6; Krebs von den Lungen-6; MAM6; MCD; MCKD; MCKD1; Medullary cystic kidney disease, autosomal dominant; Muc1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; MUC1-alpha; MUC1-beta; MUC1-CT; MUC1-NT; mucin 1, cell surface associated; mucin 1, transmembrane; Mucin1; mucin-1; Mucin-1 subunit alpha; Mucin-1 subunit beta; peanut-reactive urinary mucin; PEM; PEMT; Polymorphic epithelial mucin; PUM; tumor associated epithelial mucin; tumor-associated epithelial membrane antigen; Tumor-associated mucin | |
MUC1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MUC1 Control Fragment | |
RUO | |
MUC1 | |
Unconjugated | |
Recombinant | |
ASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHGVTS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Certificates
A lot number is required to show results for certificates. To find your lot number on previous orders use our order status area.
Lot Number | Certificate Type | Date | Catalog Number |
---|---|---|---|
AA4609669 | Certificate of Analysis | 28/01/2025 |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.