Invitrogen™ Human Nectin 2 (aa 34-157) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP90206

Product Code. 30208728

Description

This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Specifications

• Accession Number: Q92692
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 5819
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: NECTIN2
• Recombinant: Recombinant
• Expression System: E. coli

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: Nectin 2
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: AI325026; AI987993; CD112; herpes virus entry mediator B; Herpesvirus entry mediator B; herpesvirus entry protein B; hveB; mHveB; MPH; Murine herpes virus entry protein B; murine herpesvirus entry protein B; nectin cell adhesion molecule 2; Nectin2; Nectin-2; Poliovirus receptor homolog; poliovirus receptor related 2; poliovirus receptor-like 2; poliovirus receptor-related 2; poliovirus receptor-related 2 (herpesvirus entry mediator B); poliovirus receptor-related protein 2; poliovirus sensitivity; PRR2; Pvr; Pvrl2; PVRR2; Pvs
• Conjugate: Unconjugated
• Sequence: VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR