Invitrogen™ Human RNF175 (aa 9-46) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP96683

Product Code. 30208900

Description

RNF175 gene ontology annotations related to this gene include endoplasmic reticulum unfolded protein response; ubiquitin-dependent ERAD pathway.

Specifications

• Accession Number: Q8N4F7
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 285533
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: RNF175
• Species: Human
• Sequence: KAAPVLEAPPQQEQLSHTKLSAEDTWNLQQERMYKMHR
• Form: Liquid

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: RNF175
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: RING finger protein 175; RNF175
• Conjugate: Unconjugated
• Recombinant: Recombinant
• Expression System: E. coli