Invitrogen™ Human RNF208 (aa 86-170) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP93095

Product Code. 30206185

Specifications

• Accession Number: Q9H0X6
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 727800
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: RNF208
• Species: Human
• Sequence: EGAPHTPPLPRRPRKGSSELGFPRVAPEDEVIVNQYVIRPGPSASAASSAAAGEPLECPTCGHSYNVTQRRPRVLSCLHSVCEQC
• Form: Liquid

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: RNF208
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: 1110061N23Rik; RING finger protein 208; RNF208
• Conjugate: Unconjugated
• Recombinant: Recombinant
• Expression System: E. coli