Invitrogen™ Human RNF214 (aa 131-227) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP97451

Product Code. 30208313

Descrizione

RNF214 (RING finger protein 214) is a 703 amino acid protein that contains one RING-type zinc finger and is encoded by a gene that maps to human chromosome 11q23.3. Chromosome 11 houses over 1,400 genes and comprises nearly 4% of the human genome. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitz syndrome are associated with defects in genes that maps to chromosome 11.

Specifica

• Accession Number: Q8ND24
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 257160
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: RNF214
• Species: Human
• Sequence: VTRSLKAGCHTKQLASRNCSEEKSPQTSILKEGNRDTSLDFRPVVSPANGVEGVRVDQDDDQDSSSLKLSQNIAVQTDFKTADSEVNTDQDIEKNLD
• Form: Liquid

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: RNF214
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: D130054N24Rik; ring finger protein 214; Rnf214
• Conjugate: Unconjugated
• Recombinant: Recombinant
• Expression System: E. coli