Invitrogen™ Human SERC1 (aa 280-311) Control Fragment Recombinant Protein

Product Code. 30209735

Brand: Invitrogen™ RP95052

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57379 (PA5-57379. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SERINC1, also named as KIAA1253, TDE1L and TDE2, belongs to the TDE1 family. SERINC1 enhances the incorporation of serine into phosphatidylserine and sphingolipids.

Specifications

• Accession Number: Q9NRX5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57515
• Name: Human SERC1 (aa 280-311) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1500011D18Rik; AI315070; Aigp2; AIGP-2; axotomy induced glycoprotein 2; axotomy-induced glyco/Golgi protein 2; KIAA1253; LRRGT00191; Membrane protein TMS-2; mKIAA1253; Serinc1; Serine incorporator 1; Tde1l; Tde2; TMS2; TMS-2; tumor differentially expressed 1, like; tumor differentially expressed 2; Tumor differentially expressed protein 1-like; Tumor differentially expressed protein 2; UNQ396/PRO732
• Common Name: SERC1
• Gene Symbol: SERINC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TNEPETNCNPSLLSIIGYNTTSTVPKEGQSVQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining