Invitrogen™ Human WDR77 (aa 14-104) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP94078

Product Code. 30213137

Description

WDR77 is a component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles.

Specifications

• Accession Number: Q9BQA1
• For Use With (Application): Blocking Assay, Control
• Gene ID (Entrez): 79084
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Symbol: WDR77
• Species: Human
• Sequence: AREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVE
• Form: Liquid

• Concentration: ≥5.0 mg/mL
• Formulation: 1M urea, PBS with no preservative; pH 7.4
• Name: WDR77
• Storage Requirements: -20° C, Avoid Freeze/Thaw Cycles
• Gene Alias: 2610003I18Rik; 2610312E17Rik; Ac2-269; androgen receptor cofactor p44; C79984; HKMT1069; MEP50; MEP-50; Methylosome protein 50; MGC2722; Nbla10071; OTTHUMP00000013473; p44; p44/Mep50; RGD1310479; RP11-552M11.3; testis tissue sperm-binding protein Li 44a; WD repeat domain 77; WD repeat-containing protein 77; WD45; WDR77
• Conjugate: Unconjugated
• Recombinant: Recombinant
• Expression System: E. coli