Abnova™ ID1 Recombinant Protein

Human ID1 full-length ORF recombinant protein with GST-tag at N-terminal

Product Code	Brand	Quantity
16196531	Abnova™ H00003397-P01.10ug	10 μg
16106541	Abnova™ H00003397-P01.25ug	25 μg

Description

The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene.

• Theoretical MW (kDa): 42.79
• Preparation method: In vitro wheat germ expression system
• Purification: Glutathione Sepharose 4 fast flow
• Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Best use within three months from the date of receipt of this protein.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Molecular Weight (g/mol): 43.2
• Preparation Method: In vitro wheat germ expression system
• Source: Wheat Germ (in vitro)
• Recombinant: Recombinant

• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• pH Range: 8
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Cross Reactivity: Human
• Form: Solution