LMOD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Bio-Techne NBP1-85898

Product Code. 18216528

Description

LMOD3 Polyclonal specifically detects LMOD3 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LMOD3
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q0VAK6
• Gene Symbols: LMOD3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VTDKAFKEQRDRPEAQEQSEKKISKLDPKKLALDTSFLKVSTRPSGNQTDLDGSLRRVRKNDPDMKELNLNNIENIPKEMLLDFVNAMKK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DKFZp313F0135, leiomodin 3 (fetal), Leiomodin, fetal form, leiomodin-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56203
• Target Species: Human
• Isotype: IgG

For Research Use Only