Novus Biologicals™ Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP2-57484PEP

Product Code. 18294194

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C. Source: E.coli Amino Acid Sequence: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK The Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen is derived from E. coli. The Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 23081
• Common Name: Lysine (K)-specific Demethylase 4C/KDM4C/JMJD2C Recombinant Protein Antigen
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Alias: EC 1.14.11, EC 1.14.11.-, GASC-1 protein, GASC1JmjC domain-containing histone demethylation protein 3C, Gene amplified in squamous cell carcinoma 1 protein, JHDM3C, JMJD2CbA146B14.1, jumonji domain containing 2C, Jumonji domain-containing protein 2C, KIAA
• Label Type: Unlabeled
• Quantity: 100μL
• Source: E.coli

• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Symbol: KDM4C
• Product Type: Recombinant Protein Antigen
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53151. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.