missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MED28 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85104-25ul
This item is not returnable.
View return policy
Description
MED28 Polyclonal specifically detects MED28 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
MED28 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
DKFZP434N185, EG1DKFZp434N185, magicin, mediator complex subunit 281500003D12Rik, mediator of RNA polymerase II transcription, subunit 28 homolog (S. cerevisiae), subunit 28 homolog | |
Rabbit | |
Affinity Purified | |
RUO | |
80306 | |
Human, Mouse, Rat | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
MED28 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:VIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT | |
25ul | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only