Novus Biologicals™ Methionine Sulfoxide Reductase A Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP1-87456PEP

Product Code. 18725663

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MSRA. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen is derived from E. coli. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-87456. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

• Gene ID (Entrez): 4482
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Label Type: Unlabeled
• Product Type: Methionine Sulfoxide Reductase A
• Regulatory Status: RUO

• Species: Human
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Symbol: MSRA
• Molecular Weight (g/mol): 25kDa
• Quantity: 0.1mL
• Immunogen: ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG

For Research Use Only