Novus Biologicals™ Proline rich 16 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP2-13814PEP

Product Code. 18028447

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRR16. The Proline rich 16 Recombinant Protein Antigen is derived from E. coli. The Proline rich 16 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-13814. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

• Gene ID (Entrez): 51334
• Purification Method: Chromatography
• Concentration: 0.5mg/mL
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Symbol: PRR16
• Molecular Weight (g/mol): 27kDa
• Quantity: 0.1mL
• Source: E.Coli
• Immunogen: KCEDPKRVVPTANPVKTNGTLLRNGGLPGGPNKIPNGDICCIPNSNLDKAPVQLLMHRPEKDRCPQAGPRERVRFNEKVQYHGYCPDCD

• Species: Human
• Purity: >80%
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Label Type: Unlabeled
• Product Type: Proline rich 16
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13814. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only