missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ RDH11 Recombinant Protein

£290.00 - £441.00

Specifications

Accession Number	AAH00112
For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez)	51109
Molecular Weight (g/mol)	58.19

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16179632 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00051109-P01.10ug	10 μg	£290.00 10µg		Please sign in to purchase this item. Need a web account? Register with us today!

16189632 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00051109-P01.25ug	25 μg	£441.00 25µg		Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH00112
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	58.19
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	RDH11
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	51109
Name	RDH11 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	IRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID
Gene Alias	ARSDR1/CGI-82/FLJ32633/HCBP12/MDT1/PSDR1/RALR1/SCALD/SDR7C1
Gene Symbol	RDH11
Species	Wheat Germ (in vitro)
Protein Tag	GST

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ RDH11 Recombinant Protein

Specifications

Description

Specifications

Documents