Novus Biologicals™ Splicing factor, arginine/serine-rich 11 Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP1-87381PEP

Product Code. 18225289

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SRSF11. The Splicing factor, arginine/serine-rich 11 Recombinant Protein Antigen is derived from E. coli. The Splicing factor, arginine/serine-rich 11 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-87381. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

• Gene ID (Entrez): 9295
• Purification Method: Chromatography
• Concentration: 0.5mg/mL
• Formulation: PBS and 1M Urea, pH 7.4.
• Gene Symbol: SRSF11
• Molecular Weight (g/mol): 30kDa
• Quantity: 0.1mL
• Source: E.Coli
• Immunogen: LLPTPNPLTQIGAVPLAALGAPTLDPALAALGLPGANLNSQSLAADQLLKLMSTVDPKLNHVAAGLVSPSLKSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEEKRRHSRSRSR

• Species: Human
• Purity: >80%
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• For Use With (Application): Blocking/Neutralizing, Control
• Label Type: Unlabeled
• Product Type: Splicing factor, arginine/serine-rich 11
• Regulatory Status: RUO
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87381. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only