accessibility menu, dialog, popup

Test

Antibodies

Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies (15)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

bio bin

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (8)
  • (4)
  • (3)

Applications

  • (10)
  • (8)
  • (9)

Classification

  • (3)
  • (12)

Conjugate

  • (15)

Host Species

  • (3)
  • (12)

Isotype

  • (12)
  • (2)
  • (1)

Quantity

  • (8)
  • (2)
  • (4)
  • (1)

Regulatory Status

  • (15)

Target Species

  • (4)
  • (4)
  • (4)
  • (4)
  • (15)
  • (4)
  • (1)
Show all

Form

  • (3)
  • (1)
1 – 10 of 10 results
1

MBD5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunofluorescence
Isotype IgG
Antigen MBD5
Gene Symbols MBD5
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias KIAA1461, methyl-CpG binding domain protein 5, methyl-CpG-binding domain protein 5, methyl-CpG-binding protein MBD5, MRD1
Gene ID (Entrez) 55777
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGGGTNATPVVPSRAATPRSVRNKSHEGITNSVMPECKNPFKLMIGSSNAMGRLYVQELPGSQQQELHPVYPRQRLGSSEHGQKSPFRGSH
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
2

TOM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry,Immunofluorescence
Isotype IgG
Antigen TOM1
Gene Symbols TOM1
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias ADP-ribosylation factor-binding protein GGA3, golgi associated, gamma adaptin ear containing, ARF binding protein 3, golgi-associated, gamma adaptin ear containing, ARF binding protein 3, KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3
Gene ID (Entrez) 10043
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
3

SBF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. CAH18463
Antigen SBF1
Gene Symbols SBF1
Regulatory Status RUO
Molecular Weight of Antigen 91 kDa
Gene Alias myotubularin-related protein 5, DENND7A, MTMR5, SET binding factor 1
Gene ID (Entrez) 6305
Immunogen The immunogen for this antibody is SBF1 - C-terminal region. Peptide sequence YLEPTEDLAPAQEVGEAPSQEDERSALDVASEQRRLWPTLSREKQQELVQ.
Classification Polyclonal
Primary or Secondary Primary
4

ABLIM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_001096648
Antigen ABLIM1
Gene Symbols ABLIM1
Regulatory Status RUO
Molecular Weight of Antigen 62 kDa
Gene Alias ABLIM, abLIM-1, actin binding LIM protein 1, Actin-binding double zinc finger protein, actin-binding double-zinc-finger protein, actin-binding LIM protein 1, Actin-binding LIM protein family member 1, DKFZp781D0148, FLJ14564, KIAA0059, LIM actin-binding protein 1, LIMAB1MGC1224, LIMATIN
Gene ID (Entrez) 3983
Immunogen The immunogen for this antibody is Ablim1 - middle region. Peptide sequence KAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDV.
Classification Polyclonal
Primary or Secondary Primary
5

TCHP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_115676
Antigen TCHP
Gene Symbols TCHP
Regulatory Status RUO
Molecular Weight of Antigen 61 kDa
Gene Alias TpMs, trichoplein, keratin filament binding
Gene ID (Entrez) 84260
Immunogen Synthetic peptide directed towards the C terminal of human TCHP. Peptide sequence IQEKIEQNRRAQEESLKHREQLIRNLEEVRELARREKEESEKLKSARKQE.
Classification Polyclonal
Primary or Secondary Primary
6

EMC7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunocytochemistry,Immunofluorescence
Isotype IgG
Antigen EMC7
Gene Symbols EMC7
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias C11orf3, C15orf24, chromosome 15 hypothetical ATG/GTP binding protein, chromosome 15 open reading frame 24, ER membrane protein complex subunit 7, HT022, ORF1-FL1
Gene ID (Entrez) 56851
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGW
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
7

GGA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunocytochemistry,Immunofluorescence
Isotype IgG
Research Discipline Cell Biology, Golgi Apparatus Markers
Antigen GGA3
Gene Symbols GGA3
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias ADP-ribosylation factor-binding protein GGA3, golgi associated, gamma adaptin ear containing, ARF binding protein 3, golgi-associated, gamma adaptin ear containing, ARF binding protein 3, KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3
Gene ID (Entrez) 23163
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDK
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
8

ABCD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Antigen ABCD2
Gene Symbols ABCD2
Regulatory Status RUO
Gene Alias Adrenoleukodystrophy-like 1, Adrenoleukodystrophy-related protein, ALD1, ALDL1ATP-binding cassette sub-family D member 2, ALDRhALDR, ALDRPABC39, ATP-binding cassette, sub-family D (ALD), member 2
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Gene ID (Entrez) 225
Immunogen Synthetic peptides corresponding to ABCD2(ATP-binding cassette, sub-family D (ALD), member 2) The peptide sequence was selected from the middle region of ABCD2. Peptide sequence WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT.
Classification Polyclonal
Isotype IgG
Gene Accession No. Q9UBJ2
Primary or Secondary Primary
9

Human CIN85/SH3KBP1 Antibody, R&D Systems™

Mouse Monoclonal Antibody

Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Immunocytochemistry
Form Purified
Isotype IgG1
Gene Accession No. Q96B97
Antigen CIN85/SH3KBP1
Gene Symbols SH3KBP1
Regulatory Status RUO
Purification Method Protein A or G purified from hybridoma culture supernatant
Dilution Immunocytochemistry 8-25 ug/mL
Gene Alias c-Cbl-interacting protein, CD2-binding protein 3, CD2BP3, CIN85Cbl-interacting protein of 85 kDa, GIG10, HSB1, HSB-1, Human Src family kinase-binding protein 1, MIG18, migration-inducing gene 18, SH3 domain-containing kinase-binding protein 1, SH3-domain kinase binding protein 1, SH3KBP1, Src family kinase-binding protein 1, src-related kinase binding protein-1
Gene ID (Entrez) 30011
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Immunogen E. coli-derived recombinant human CIN85/SH3KBP1 Pro366-Lys665 Accession # Q96B97
Classification Monoclonal
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Primary or Secondary Primary
Test Specificity Detects human CIN85/SH3KBP1 in direct ELISAs.
Clone 931346