All Primary Antibodies
All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (10)
- (8)
- (9)
- (3)
- (12)
- (15)
- (3)
- (12)
- (12)
- (2)
- (1)
Filtered Search Results
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Antigen | MBD5 |
Gene Symbols | MBD5 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | KIAA1461, methyl-CpG binding domain protein 5, methyl-CpG-binding domain protein 5, methyl-CpG-binding protein MBD5, MRD1 |
Gene ID (Entrez) | 55777 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGGGTNATPVVPSRAATPRSVRNKSHEGITNSVMPECKNPFKLMIGSSNAMGRLYVQELPGSQQQELHPVYPRQRLGSSEHGQKSPFRGSH |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Antigen | TOM1 |
Gene Symbols | TOM1 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | ADP-ribosylation factor-binding protein GGA3, golgi associated, gamma adaptin ear containing, ARF binding protein 3, golgi-associated, gamma adaptin ear containing, ARF binding protein 3, KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3 |
Gene ID (Entrez) | 10043 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQ |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | CAH18463 |
Antigen | SBF1 |
Gene Symbols | SBF1 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 91 kDa |
Gene Alias | myotubularin-related protein 5, DENND7A, MTMR5, SET binding factor 1 |
Gene ID (Entrez) | 6305 |
Immunogen | The immunogen for this antibody is SBF1 - C-terminal region. Peptide sequence YLEPTEDLAPAQEVGEAPSQEDERSALDVASEQRRLWPTLSREKQQELVQ. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | NP_001096648 |
Antigen | ABLIM1 |
Gene Symbols | ABLIM1 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 62 kDa |
Gene Alias | ABLIM, abLIM-1, actin binding LIM protein 1, Actin-binding double zinc finger protein, actin-binding double-zinc-finger protein, actin-binding LIM protein 1, Actin-binding LIM protein family member 1, DKFZp781D0148, FLJ14564, KIAA0059, LIM actin-binding protein 1, LIMAB1MGC1224, LIMATIN |
Gene ID (Entrez) | 3983 |
Immunogen | The immunogen for this antibody is Ablim1 - middle region. Peptide sequence KAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDV. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Host Species | Rabbit |
---|---|
Conjugate | Unconjugated |
Applications | Western Blot |
Isotype | IgG |
Gene Accession No. | NP_115676 |
Antigen | TCHP |
Gene Symbols | TCHP |
Regulatory Status | RUO |
Molecular Weight of Antigen | 61 kDa |
Gene Alias | TpMs, trichoplein, keratin filament binding |
Gene ID (Entrez) | 84260 |
Immunogen | Synthetic peptide directed towards the C terminal of human TCHP. Peptide sequence IQEKIEQNRRAQEESLKHREQLIRNLEEVRELARREKEESEKLKSARKQE. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Antigen | EMC7 |
Gene Symbols | EMC7 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | C11orf3, C15orf24, chromosome 15 hypothetical ATG/GTP binding protein, chromosome 15 open reading frame 24, ER membrane protein complex subunit 7, HT022, ORF1-FL1 |
Gene ID (Entrez) | 56851 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGW |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Target Species | Human |
---|---|
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunocytochemistry,Immunofluorescence |
Isotype | IgG |
Research Discipline | Cell Biology, Golgi Apparatus Markers |
Antigen | GGA3 |
Gene Symbols | GGA3 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | ADP-ribosylation factor-binding protein GGA3, golgi associated, gamma adaptin ear containing, ARF binding protein 3, golgi-associated, gamma adaptin ear containing, ARF binding protein 3, KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3 |
Gene ID (Entrez) | 23163 |
Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDK |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Antigen | ABCD2 |
---|---|
Gene Symbols | ABCD2 |
Regulatory Status | RUO |
Gene Alias | Adrenoleukodystrophy-like 1, Adrenoleukodystrophy-related protein, ALD1, ALDL1ATP-binding cassette sub-family D member 2, ALDRhALDR, ALDRPABC39, ATP-binding cassette, sub-family D (ALD), member 2 |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Gene ID (Entrez) | 225 |
Immunogen | Synthetic peptides corresponding to ABCD2(ATP-binding cassette, sub-family D (ALD), member 2) The peptide sequence was selected from the middle region of ABCD2. Peptide sequence WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT. |
Classification | Polyclonal |
Isotype | IgG |
Gene Accession No. | Q9UBJ2 |
Primary or Secondary | Primary |
Content And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. |
---|---|
Target Species | Human |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Immunocytochemistry |
Form | Purified |
Isotype | IgG1 |
Gene Accession No. | Q96B97 |
Antigen | CIN85/SH3KBP1 |
Gene Symbols | SH3KBP1 |
Regulatory Status | RUO |
Purification Method | Protein A or G purified from hybridoma culture supernatant |
Dilution | Immunocytochemistry 8-25 ug/mL |
Gene Alias | c-Cbl-interacting protein, CD2-binding protein 3, CD2BP3, CIN85Cbl-interacting protein of 85 kDa, GIG10, HSB1, HSB-1, Human Src family kinase-binding protein 1, MIG18, migration-inducing gene 18, SH3 domain-containing kinase-binding protein 1, SH3-domain kinase binding protein 1, SH3KBP1, Src family kinase-binding protein 1, src-related kinase binding protein-1 |
Gene ID (Entrez) | 30011 |
Formulation | Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative |
Immunogen | E. coli-derived recombinant human CIN85/SH3KBP1 Pro366-Lys665 Accession # Q96B97 |
Classification | Monoclonal |
Reconstitution | Reconstitute at 0.5 mg/mL in sterile PBS. |
Primary or Secondary | Primary |
Test Specificity | Detects human CIN85/SH3KBP1 in direct ELISAs. |
Clone | 931346 |