All Primary Antibodies
All Primary Antibodies
Primary antibodies, immunoglobulins that bind to specific proteins or other biomolecules, are used in many research applications and protocols to detect targets of interest. They are developed using different animal hosts, including mouse, rat, rabbit, goat, sheep, and many others.
Monoclonal and Polyclonal Antibodies
One type of primary antibodies, monoclonal antibodies, provides high reproducibility and low cross-reactivity and background noise. Another type, polyclonal antibodies, often costs less and provides greater affinity and quicker binding. Both are produced using plasma B cells, but the former uses the same clone and the latter uses different clones. Monoclonal antibodies require hybridoma cell lines, and polyclonal antibodies do not.
There are also recombinant monoclonal antibodies with similar benefits, like high affinity, scalability, and specificity. They are produced using in vitro cloning of plasma B cells and expression hosts.
Conjugated Primary Antibodies
Antibodies can be labeled with various fluorophores or detection agents or used without labels. Labeled primary antibodies, also known as conjugated primary antibodies, help researchers simplify and streamline their applications. They are coupled with common enzymes and dyes such as Alexa Fluor and often used in protein and cell analysis.
Applications
Antibodies for life sciences applications are used in flow cytometry, western blotting, ELISA, immunohistochemistry, and immunocytochemistry. Secondary antibodies can be added to support the detection and purification of certain antigens. They bind to the primary antibody, which binds to the antigen of interest. Finding the right combination of antibodies can result in greater antigen specificity and a strong, detectable signal.
- (12)
- (4)
- (4)
- (188)
- (134)
- (1)
- (1)
- (1)
- (1)
- (760)
- (11)
- (126)
- (478)
- (14)
- (2)
- (808)
- (221)
- (2)
- (1)
- (1)
- (1,941)
- (3)
- (97)
- (271)
- (1,921)
- (1)
- (1)
- (1)
- (271)
- (1)
- (1)
- (5)
- (1,228)
- (319)
- (5)
- (77)
- (5)
- (116)
- (133)
- (24)
- (1)
- (1)
- (8)
- (43)
- (34)
- (13)
- (1)
- (2)
- (7)
- (1)
- (1)
- (11)
- (15)
- (6)
- (3)
- (2)
- (11)
- (1)
- (1)
- (1)
- (8)
- (2)
- (2,218)
- (887)
- (35)
- (2)
- (1)
- (7)
- (11)
- (539)
- (2)
- (3)
- (2)
- (1)
- (6)
- (9)
- (10)
- (11)
- (11)
- (10)
- (9)
- (11)
- (12)
- (10)
- (17)
- (14)
- (2)
- (2)
- (12)
- (11)
- (14)
- (13)
- (14)
- (15)
- (12)
- (11)
- (11)
- (15)
- (13)
- (14)
- (9)
- (5)
- (1,982)
- (1)
- (1)
- (1)
Filtered Search Results
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Immunohistochemistry,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | A8MTL3 |
Antigen | C14orf164 |
Gene Symbols | RNF212B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Gene Alias | Chromosome 14 Open Reading Frame 164, RING Finger Protein C14orf164, RING Finger Protein C14orf164-Like |
Gene ID (Entrez) | 100507650 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ASTHSLSYRTSSASSGQGIFSFRPSPNGHSGHTRVLTPNNFAQRESTTTLESLPSFQLPVLQTLYQQRRHMGLPSGR |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Antigen | Ring finger protein 214 |
Gene Symbols | RNF214 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
Gene Alias | DKFZp547C195, ring finger protein 214 |
Gene ID (Entrez) | 257160 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VTRSLKAGCHTKQLASRNCSEEKSPQTSILKEGNRDTSLDFRPVVSPANGVEGVRVDQDDDQDSSSLKLSQNIAVQTDFKTADSEVNTDQDIEKNLD |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunocytochemistry |
Form | Purified |
Isotype | IgG |
Research Discipline | Zinc Finger |
Antigen | Ring finger protein 138 |
Regulatory Status | RUO |
Purification Method | Immunogen affinity purified |
Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
Gene Alias | E3 ubiquitin-protein ligase RNF138, EC 6.3.2.-, hNARF, HSD-4, MGC8758, NARF, Nemo-like kinase-associated RING finger protein, ring finger protein 138NLK-associated RING finger protein, STRIN |
Gene ID (Entrez) | 51444 |
Formulation | PBS (pH 7.2) and 40% Glycerol |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YCPVCREVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYR |
Classification | Polyclonal |
Primary or Secondary | Primary |
Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Form | Purified |
Isotype | IgG |
Research Discipline | Zinc Finger |
Antigen | Ring finger protein 138 |
Regulatory Status | RUO |
Purification Method | Affinity purified |
Dilution | Western Blot 1:500-1:2000 |
Gene Alias | E3 ubiquitin-protein ligase RNF138, EC 6.3.2.-, hNARF, HSD-4, MGC8758, NARF, Nemo-like kinase-associated RING finger protein, ring finger protein 138NLK-associated RING finger protein, STRIN |
Gene ID (Entrez) | 51444 |
Formulation | PBS (pH 7.3), 50% glycerol |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-245 of mouse Ring finger protein 138 (Q9CQE0). SVTRRERACPERALDLENIMRRFSGSCRCCSKKIKFYRMRHHYKSCKKYQDEYGVSSVIPNFKISQDSVRSSNRSETSASDNTETYQEDTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNLQLDEETQYQTAVEESFQVNM |
Classification | Polyclonal |
Primary or Secondary | Primary |
praja ring finger 2, Mouse, Clone: 1G11, Abnova™
Mouse monoclonal antibody raised against a partial recombinant PJA2.
ring finger protein 41, Mouse, Clone: 4C2, Abnova™
Mouse monoclonal antibody raised against a partial recombinant RNF41.
ring finger protein 138, Mouse, Clone: 3G2, Abnova™
Mouse monoclonal antibody raised against a partial recombinant RNF138.
ring finger protein 34, Mouse, Polyclonal Antibody, Abnova™
Mouse polyclonal antibody raised against a full-length human RNF34 protein.
ring finger protein 182, Mouse, Polyclonal Antibody, Abnova™
Mouse polyclonal antibody raised against a partial recombinant RNF182.
ring finger protein 8, Mouse, Polyclonal Antibody, Abnova™
Mouse polyclonal antibody raised against a full-length human RNF8 protein.