missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ EIF4EBP1 (Human) Recombinant Protein
Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00001978-P01.10ug
This item is not returnable.
View return policy
Description
- Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Specifications
AAH04459 | |
eukaryotic translation initiation factor 4E binding protein 1 | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
EIF4EBP1 | |
GST |
1978 | |
Wheat germ expression system | |
10 μg | |
4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction