missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ EIF4EBP1 (Human) Recombinant Protein
Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
£290.00 - £441.00
Specifications
| Accession Number | AAH04459 |
|---|---|
| Gene ID (Entrez) | 1978 |
| Name | eukaryotic translation initiation factor 4E binding protein 1 |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16104441
|
Abnova™
H00001978-P01.10ug |
10 μg |
£290.00
10µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
16114441
|
Abnova™
H00001978-P01.25ug |
25 μg |
£441.00
25µg |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
- Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Specifications
| AAH04459 | |
| eukaryotic translation initiation factor 4E binding protein 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| 4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 1978 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EIF4EBP1 | |
| GST |
Safety and Handling
missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title