missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Hyaluronan Synthase 3/HAS3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP1-86328-25ul
This item is not returnable.
View return policy
Description
Hyaluronan Synthase 3/HAS3 Polyclonal specifically detects Hyaluronan Synthase 3/HAS3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
Hyaluronan Synthase 3/HAS3 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
EC 2.4.1.212, HA synthase 3, hyaluronan synthase 3, Hyaluronate synthase 3, Hyaluronic acid synthase 3 | |
Rabbit | |
Affinity Purified | |
RUO | |
3038 | |
Rat, Mouse, Rat | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
HAS3 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC | |
25 μL | |
Primary | |
Specificity of human Hyaluronan Synthase 3/HAS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Suggestions
Customers who viewed this item also viewed
Viewing 1-5 of 12
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Hyaluronan Synthase 3/HAS3 Antibody, Novus Biologicals™ > 25 μL; Unlabeled
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction