Hyaluronan Synthase 3/HAS3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18452431	Novus Biologicals NBP1-86328-25ul	25 μL
18798203	Novus Biologicals NBP1-86328	0.1 mL

Description

Hyaluronan Synthase 3/HAS3 Polyclonal specifically detects Hyaluronan Synthase 3/HAS3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Hyaluronan Synthase 3/HAS3
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Gene Alias: EC 2.4.1.212, HA synthase 3, hyaluronan synthase 3, Hyaluronate synthase 3, Hyaluronic acid synthase 3
• Gene Symbols: HAS3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human Hyaluronan Synthase 3/HAS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Classification: Polyclonal
• Host Species: Rabbit
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 3038
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only