missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Bio-Techne NBP1-87578
This item is not returnable.
View return policy
Description
Muscarinic Acetylcholine Receptor M5/CHRM5 Polyclonal specifically detects Muscarinic Acetylcholine Receptor M5/CHRM5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Muscarinic Acetylcholine Receptor M5/CHRM5 | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
cholinergic receptor, muscarinic 5, HM5, MGC41838, muscarinic acetylcholine receptor M5 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CHRM5 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:AHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRK | |
0.1 mL | |
GPCR, Neuroscience | |
1133 | |
Human | |
IgG |
For Research Use Only