Muscarinic Acetylcholine Receptor M5/CHRM5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18437041	Novus Biologicals NBP1-87578-25ul	25 μL
18246006	Bio-Techne NBP1-87578	0.1 mL

Description

Muscarinic Acetylcholine Receptor M5/CHRM5 Polyclonal specifically detects Muscarinic Acetylcholine Receptor M5/CHRM5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Muscarinic Acetylcholine Receptor M5/CHRM5
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: GPCR, Neuroscience
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 1133
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRK
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: cholinergic receptor, muscarinic 5, HM5, MGC41838, muscarinic acetylcholine receptor M5
• Gene Symbols: CHRM5
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only